PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_13832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 874aa    MW: 96187.8 Da    PI: 5.2263
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_13832genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding353.3e-112331648
                     HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     vk++G++ W+tI++ ++ gR +kqc++rw+++l
       PEQU_13832  2 VKKHGPKKWSTISQALP-GRIGKQCRERWHNHL 33
                     9****************.*************97 PP

2Myb_DNA-binding48.61.9e-153981145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +++WT+eE+  l++a++ +G++ W+   + ++ gR+++++k++w+
       PEQU_13832 39 KDAWTQEEEMALIQAHQIYGNK-WAELTKFLP-GRSDNSIKNHWN 81
                     679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001676.67E-9133No hitNo description
SMARTSM007170.093135IPR001005SANT/Myb domain
PROSITE profilePS5129423.42137IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-19140IPR009057Homeodomain-like
PfamPF002493.5E-9233IPR001005SANT/Myb domain
SuperFamilySSF466899.18E-281389IPR009057Homeodomain-like
SMARTSM007174.2E-153886IPR001005SANT/Myb domain
PROSITE profilePS5129418.6023888IPR017930Myb domain
PfamPF002491.1E-133982IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-214188IPR009057Homeodomain-like
CDDcd001678.51E-124181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 874 aa     Download sequence    Send to blast
MVKKHGPKKW STISQALPGR IGKQCRERWH NHLNPTINKD AWTQEEEMAL IQAHQIYGNK  60
WAELTKFLPG RSDNSIKNHW NSSVKKKLES YMVQGLIGRY PGLTNVNSST SRIRKKNHDG  120
GLKERPDMED SSECSSSALV ASSQSECEMA KPVVGEDAIK EEAMDSHLPV CSSEYYGSVE  180
KMICDDVPSE VHSTGNLLPK DEGSATEIKK PSETDSNDND HENKDILFHK PTPLETSTSG  240
AGSGFENKDK TWISLHNGCS SNLFDSVTTL GMENLDCAAA LSYKSAIHRS GTSMNFVPFS  300
YPIFPVNTSH VYGIPCFQNL TTVPPSFICP SASVEIQDTS WRLQNSGAVA GLFIGVPKSG  360
CPAALVPEAS SLIHETIDQQ LESVVQEQEK LSIEETLTAT DCCDNVSRNL SLINEEKVEQ  420
ENVLEPGTVS PAEKMKEIQS ENFLDSGSLF YEPPRIQSLE FPFVCCDIVS SDLQQAYSPL  480
GIRQLMMSSA SCNLWDSPSR DDSPDGILKH AAKSFICTPS IMKKRQRELL SPLQERRSDK  540
KYGTDMNRGS FFVPLMKGDE AYIEDMIGEV DPENVYLSLV DDVRDSSSDL KDKHVTITKQ  600
NENLGAKLTQ KSTCSKSSRA SKLKQNVEDW RYGTKVPSDV DSDAKEAQCN AVLAERISSN  660
LESLSACSTF ISPGACGTKH AECSVTLTSL QYPPSSKKPQ IAVEKFAPSI DADHEIFNIF  720
ADTPGIKKGL DSPSSWKSPL FLNSFLAGAD FTCEDFRYFM SPGERSYDAL GLMKQLSEKN  780
AGVIAEAQEV LSNGGQKLNF DNVKSNNSSR ENEDSAKEQE NLIPMPSNIV AEGRVLDFTG  840
CNTPLEKTKS LKTKHVSSPS ISSPTTSHLL RGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-3818818105C-Myb DNA-Binding Domain
1msf_C2e-3818818105C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-50myb domain protein 3r-4